« Back
Home /
Recombinant Human Zinc finger protein 384(ZNF384),partial

Recombinant Human Zinc finger protein 384(ZNF384),partial

Item no.	CSB-RP034554h-1
Manufacturer	Cusabio
Amount	1mg
Category	Oncology Neuroscience Neuroinflammation Targets for Rodent Neurosciences Aging & Neurological Disorders Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CAG repeat protein 1,CAS-interacting zinc finger protein,Nuclear matrix transcription factor 4,Short name:,Nuclear matrix protein 4,Trinucleotide repeat-containing gene 1 protein
Available
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q8TF68
Gene Names	ZNF384
Organism	Homo sapiens (Human)
AA Sequence	MEESHFNSNPYFWPSIPTVSGQIENTMFINKMKDQ LLPEKGCGLAPPHYPTLLTVPASVSLPSGISMDTE SKSDQLTPHSQASVTQNITVVPVPSTGLMTAGVSC SQRWRREGSQSRGPGLVITSPSGSLVTTASSAQTF PISAPMIVSALPPGSQALQVVPDLSKKVASTLTEE GGGGGGGGGSVAPKPPRGRKKKRMLESGLPEMNDP YVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQI
Expression Region	1-245aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	53.1 kDa
Alternative Name(s)	CAG repeat protein 1 CAS-interacting zinc finger protein Nuclear matrix transcription factor 4 Short name: Nuclear matrix protein 4 Trinucleotide repeat-containing gene 1 protein
Relevance	Transcription factor that binds the consensus DNA sequence [GC]AAAAA. Seems to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1 (By similarity).
Reference	The finished DNA sequence of human chromosome 12.Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time