Comparison

Recombinant Human Rho guanine nucleotide exchange factor 7(ARHGEF7) ,partial

Item no. CSB-RP014454h-1
Manufacturer Cusabio
Amount 1mg
Category
Type Proteins Recombinant
Specific against other
Host E.coli
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Beta-PixCOOL-1;PAK-interacting exchange factor betap85
Available
Research Topic
Neuroscience
Uniprot ID
Q14155
Gene Names
ARHGEF7
Organism
Homo sapiens (Human)
AA Sequence
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASL KDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNI REFLRGCGASLRLELLFPPSQPPQHLVTTILLSAS TFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSD SVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYR SLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDV IHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASE KPVSP
Expression Region
1-250aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
54.8 kDa
Alternative Name(s)
Beta-PixCOOL-1; PAK-interacting exchange factor betap85
Relevance
Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce mbrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions . May function as a positive regulator of apoptosis. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons.3 Publications
Reference
The DNA sequence and analysis of human chromosome 13.Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.Nature 428:522-528(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Acts as a RAC1 guanine nucleotide exchange factor (GEF) and can induce membrane ruffling. Functions in cell migration, attachment and cell spreading. Promotes targeting of RAC1 to focal adhesions (By similarity). May function as a positive regulator of apoptosis. Downstream of NMDA receptors and CaMKK-CaMK1 signaling cascade, promotes the formation of spines and synapses in hippocampal neurons.
Subcellular Location
Cell junction, focal adhesion, Cell projection, ruffle, Cytoplasm, cell cortex, Cell projection, lamellipodium
Paythway
Regulationofactincytoskeleton

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close