Item no. |
CSB-RP001344h-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Quantity options |
1mg
10ug
100ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Host |
E.coli |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
V-ATPase 13KDA subunit 1Vacuolar proton pump subunit G 1Vacuolar proton pump subunit M16 |
Available |
|
Research Topic |
Transport |
Uniprot ID |
O75348 |
Gene Names |
ATP6V1G1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
ASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQA KEEAQAEIEQYRLQREKEFKAKEAAALGSRGSCST EVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDI RPEIHENYRING |
Expression Region |
2-118aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
40.6 kDa |
Alternative Name(s) |
V-ATPase 13KDA subunit 1Vacuolar proton pump subunit G 1Vacuolar proton pump subunit M16 |
Relevance |
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. |
Reference |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. In aerobic conditions, involved in intracellular iron homeostasis, thus triggering the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, and leading to HIF1A hydroxylation and subsequent proteasomal degradation |
Protein Families |
V-ATPase G subunit family |
Tissue Specificity |
Ubiquitous. |
Paythway |
mTORsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.