« Back
Home /
Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial

Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial

Item no.	CSB-RP000474he1-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Metabolism
Uniprot ID	P00338
Gene Names	LDHA
Organism	Homo sapiens (Human)
AA Sequence	KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISI LMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRT PKIVSGKDYNVTANSKLVIITAGARQQEGESRLNL VQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILT YVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLG VHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTL HPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTS WAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIK DDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKS ADTL
Expression Region	5-323aa
Sequence Info	Partial
Source	E.coli
Tag Info	NO-tagged
MW	35.1 kDa
Relevance	Cell proliferation-inducing gene 19 protein LDH muscle subunit
Reference	"Nucleotide sequences of the cDNA and an intronless pseudogene for human lactate dehydrogenase-A isozyme." Tsujibo H., Tiano H.F., Li S.S.-L. Eur. J. Biochem. 147:9-15(1985)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

not available