« Back
Home /
Recombinant Mouse Anthrax toxin receptor 1(Antxr1),partial

Recombinant Mouse Anthrax toxin receptor 1(Antxr1),partial

Item no.	CSB-MP001832MO-20
Manufacturer	Cusabio
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Mammalian cells
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor endothelial marker 8
Available
Research Areas	Tags & Cell Markers
Uniprot ID	Q9CZ52
Gene Names	Antxr1
Organism	Mus musculus (Mouse)
AA Sequence	EDGGPACYGGFDLYFILDKSGSVLHHWNEIYYFVE QLAHRFISPQLRMSFIVFSTRGTTLMKLTEDREQI RQGLEELQKVLPGGDTYMHEGFERASEQIYYENSQ GYRTASVIIALTDGELHEDLFFYSEREANRSRDLG AIVYCVGVKDFNETQLARIADSKDHVFPVNDGFQA LQGIIHSILKKSCIEILAAEPSTICAGESFQVVVR GNGFRHARNVDRVLCSFKINDSVTLNEKPFAVEDT YLLCPAPILKEVGMKAALQVSMNDGLSFISSSVII TTTHCSDGS
Expression Region	31-319aa
Sequence Info	Partial
Source	Mammalian cell
Tag Info	N-terminal 6xHis-tagged
MW	36.3 kDa
Alternative Name(s)	Tumor endothelial marker 8
Relevance	Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells (By similarity).
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004).
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells (By similarity).
Subcellular Location	Cell membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell projection, filopodium membrane, Single-pass type I membrane protein
Protein Families	ATR family
Tag Information	N-terminal 6xHis-Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Request delivery time