« Back
Home /
Recombinant Mouse 2-Hydroxyacid oxidase 1(Hao1)

Recombinant Mouse 2-Hydroxyacid oxidase 1(Hao1)

Item no.	CSB-EP894819MO-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,HAOX1,Alternative name(s):,Glycolate oxidase,Short name:,GOX
Available
Research areas	Tags & Cell Markers
Target / Protein	Hao1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	Q9WU19
AA Sequence	MLPRLVCISDYEQHVRSVLQKSVYDYYRSGANDQE TLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQR VSMPICVGATAMQCMAHVDGELATVRACQTMGTGM MLSSWATSSIEEVAEAGPEALRWMQLYIYKDREIS RQIVKRAEKQGYKAIFVTVDTPYLGNRIDDVRNRF KLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVA QAIDPSLSWDDITWLRRLTSLPIVVKGILRGDDAK EAVKHGVDGILVSNHGARQLDGVPATIDVLPEIVE AVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGR PIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQ NVKVIDKTLVRKNPLAVSKI
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-370aa
Protein length	Full Length
MW	45 kDa
Alternative Name(s)	Short name: HAOX1 Alternative name(s): Glycolate oxidase Short name: GOX
Relevance	Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate (By similarity).
References	"SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways."Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930(2013).
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has 2-hydroxyacid oxidase activity. Most active on the 2-carbon substrate glycolate, but is also active on 2-hydroxy fatty acids, with high activity towards 2-hydroxy palmitate and 2-hydroxy octanoate (By similarity).
Subcellular Location	Peroxisome
Protein Families	FMN-dependent alpha-hydroxy acid dehydrogenase family
Tissue Specificity	Liver.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time