Recombinant Human F-box only protein 2(FBXO2)

Cell Biology

FBXO2

MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQ QEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQA CRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEE ERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVE HGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEW CRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGR SDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDS DGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWK GWFGARVTNSSVWVEP

Full Length

N-terminal GST-tagged

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type

Greater than 90% as determined by SDS-PAGE.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Involved in the endoplasmic reticulum-associated degradation pathway (ERAD) for misfolded lumenal proteins by recognizing and binding sugar chains on unfolded glycoproteins that are retrotranslocated into the cytosol and promoting their ubiquitination and subsequent degradation. Prevents formation of cytosolic aggregates of unfolded glycoproteins that have been retrotranslocated into the cytosol. Able to recognize and bind denatured glycoproteins, preferentially those of the high-mannose type (By similarity).

Proteinprocessinginendoplasmicreticulum