Item no. |
CSB-EP889914MO-1 |
Manufacturer |
Cusabio
|
Amount |
1mg |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,ADAM-TS 5,Short name:,ADAM-TS5,Short name:,ADAMTS-5,Alternative name(s):,ADMP-2,Aggrecanase-2,Implantin |
Available |
|
Research Areas |
Signal Transduction |
Uniprot ID |
Q9R001 |
Gene Names |
Adamts5 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
SISRARQVELLLVADSSMARMYGRGLQHYLLTLAS IANRLYSHASIENHIRLAVVKVVVLTDKDTSLEVS KNAATTLKNFCKWQHQHNQLGDDHEEHYDAAILFT REDLCGHHSCDTLGMADVGTICSPERSCAVIEDDG LHAAFTVAHEIGHLLGLSHDDSKFCEENFGTTEDK RLMSSILTSIDASKPWSKCTSATITEFLDDGHGNC LLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYS VCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTP CGKGRVCLQGKCVDKTKKKYYSTSSHGNWGSWGPW GQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRA IYRSCSVTPCPPNGKSFRHEQCEAKNGYQSDAKGV KTFVEWVPKYAGVLPADVCKLTCRAKGTGYYVVFS PKVTDGTECRPYSNSVCVRGRCVRTGCDGIIGSKL QYDKCGVCGGDNSSCTKIIGTFNKKSKGYTDVVRI PEGATHIKVRQFKAKDQTRFTAYLALKKKTGEYLI NGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGM GYSATKEILIVQILATDPTKALDVRYSFFVPKKTT QKVNSVISHGSNKVGPHSTQLQWVTGPWLACSRTC DTGWHTRTVQCQDGNRKLAKGCLLSQRPSAFKQCL LKKC |
Expression Region |
262-930aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
77.8 kDa |
Alternative Name(s) |
Short name: ADAM-TS 5 Short name: ADAM-TS5 Short name: ADAMTS-5 Alternative name(s): ADMP-2 Aggrecanase-2 Implantin |
Relevance |
Cleaves aggrecan, a cartilage proteoglycan, and may be involved in its turnover. May play an important role in the destruction of aggrecan in arthritic diseases. May play a role in proteolytic processing mostly during the peri-implantation period. |
Reference |
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Metalloproteinase that plays an important role in connective tissue organization, development, inflammation, arthritis, and cell migration. ADAMTS5 is an extracellular matrix (ECM) degrading enzyme that show proteolytic activity toward the hyalectan group of chondroitin sulfate proteoglycans (CSPGs) including aggrecan, versican, brevican and neurocan. Cleavage within the hyalectans occurs at Glu-Xaa recognition motifs. Plays a role in embryonic development, including limb and cardiac morphogenesis, and skeletal muscle development through its versican remodeling properties. Participates in the development of brown adipose tissue and browning of white adipose tissue |
Subcellular Location |
Secreted, extracellular space, extracellular matrix |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.