« Back
Home /
Recombinant Human FK506-binding protein-like(FKBPL)

Recombinant Human FK506-binding protein-like(FKBPL)

Item no.	CSB-EP883441HU-200
Manufacturer	Cusabio
Amount	200ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	WAF-1/CIP1 stabilizing protein 39
Available
Research Topic	Cell Biology
Uniprot ID	Q9UIM3
Gene Names	FKBPL
Organism	Homo sapiens (Human)
AA Sequence	METPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQI RQQPRDPPTETLELEVSPDPASQILEHTQGAEKLV AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFV KKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEG WTELTMGVGPWREETWGELIEKCLESMCQGEEAEL QLPGHSGPPVRLTLASFTQGRDSWELETSEKEALA REERARGTELFRAGNPEGAARCYGRALRLLLTLPP PGPPERTVLHANLAACQLLLGQPQLAAQSCDRVLE REPGHLKALYRRGVAQAALGNLEKATADLKKVLAI DPKNRAAQEELGKVVIQGKNQDAGLAQGLRKMFG
Expression Region	1-349aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	65.2 kDa
Alternative Name(s)	WAF-1/CIP1 stabilizing protein 39
Relevance	May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.
Reference	"A novel human stress response-related gene with a potential role in induced radioresistance." Robson T., Joiner M.C., Wilson G.D., McCullough W., Price M.E., Logan I., Jones H., McKeown S.R., Hirst D.G. Radiat. Res. 152:451-461(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be involved in response to X-ray. Regulates p21 protein stability by binding to Hsp90 and p21.
Tissue Specificity	Ubiquitously expressed with higher levels in testis.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time