« Back
Home /
Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

Recombinant Human Protein phosphatase 1 regulatory subunit 1B(PPP1R1B)

Item no.	CSB-EP880070HU-500
Manufacturer	Cusabio
Amount	500ug
Category	Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DARPP-32,Dopamine- and cAMP-regulated neuronal phosphoprotein
Available
Research Topic	Neuroscience
Uniprot ID	Q9UD71
Gene Names	PPP1R1B
Organism	Homo sapiens (Human)
AA Sequence	MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNP CAYTPPSLKAVQRIAESHLQSISNLNENQASEEED ELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEV LKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDG GSEDQVEDPALSEPGEEPQRPSPSEPGT
Expression Region	1-168aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	45.7 kDa
Alternative Name(s)	DARPP-32 Dopamine- and cAMP-regulated neuronal phosphoprotein
Relevance	Inhibitor of protein-phosphatase 1.
Reference	"Expression of mRNAs encoding ARPP-16/19, ARPP-21, and DARPP-32 in human brain tissue." Brene S., Lindefors N., Ehrlich M., Taubes T., Horiuchi A., Kopp J., Hall H., Sedvall G., Greengard P., Persson H. J. Neurosci. 14:985-998(1994)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibitor of protein-phosphatase 1.
Subcellular Location	Cytoplasm
Protein Families	Protein phosphatase inhibitor 1 family
Paythway	cAMPsignalingpathway
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time