« Back
Home /
Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase(LHPP)

Recombinant Human Phospholysine phosphohistidine inorganic pyrophosphate phosphatase(LHPP)

Item no.	CSB-EP867114HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Metabolism
Uniprot ID	Q9H008
Gene Names	LHPP
Organism	Homo sapiens (Human)
AA Sequence	MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAG SVEAVARLKRSRLKVRFCTNESQKSRAELVGQLQR LGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDG VRSEFDQIDTSNPNCVVIADAGESFSYQNMNNAFQ VLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKA LEYACGIKAEVVGKPSPEFFKSALQAIGVEAHQAV MIGDDIVGDVGGAQRCGMRALQVRTGKFRPSDEHH PEVKADGYVDNLAEAVDLLLQHADK
Expression Region	1-270aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	45.2 kDa
Relevance	Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency .
Reference	Molecular cloning of a cDNA for the human phospholysine phosphohistidine inorganic pyrophosphate phosphatase.Yokoi F., Hiraishi H., Izuhara K.J. Biochem. 133:607-614(2003)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Phosphatase that hydrolyzes imidodiphosphate, 3-phosphohistidine and 6-phospholysine. Has broad substrate specificity and can also hydrolyze inorganic diphosphate, but with lower efficiency (By similarity).
Subcellular Location	Cytoplasm, Nucleus
Protein Families	HAD-like hydrolase superfamily
Tissue Specificity	Expressed in brain, and at lower levels in liver and kidney. Detected in thyroid (at protein level). Expressed in liver, kidney and moderately in brain.
Paythway	OxidativePhosphorylation
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time