« Back
Home /
Recombinant Human E3 ubiquitin-protein ligase TRAIP(TRAIP)

Recombinant Human E3 ubiquitin-protein ligase TRAIP(TRAIP)

Item no.	CSB-EP866296HUa0-50
Manufacturer	Cusabio
Amount	50ug
Category	Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Others
Target / Protein	TRAIP
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q9BWF2
AA Sequence	MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLI QWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEE ENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIID TLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMK YLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQS QRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYEN LKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQ AKLELKSAQKDLQSADKEIMSLKKKLTMLQETLNL PPVASETVDRLVLESPAPVEVNLKLRRPSFRDDID LNATFDVDTPPARPSSSQHGYYEKLCLEKSHSPIQ DVPKKICKGPRKESQLSLGGQSCAGEPDEELVGAF PIFVRNAILGQKQPKRPRSESSCSKDVVRTGFDGL GGRTKFIQPTDTVMIRPLPVKPKTKVKQRVRVKTV PSLFQAKLDTFLWS
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-469aa
Protein length	Full Length
MW	58.8 kDa
Alternative Name(s)	RING finger protein 206 RING-type E3 ubiquitin transferase TRAIPCurated TRAF-interacting protein RNF206, TRIP
Relevance	E3 ubiquitin ligase acting as a negative regulator of innate immune signaling. Inhibits activation of NF-kappa-B mediated by TNF. Negatively regulates TLR3/4- and RIG-I-mediated IRF3 activation and subsequent IFNB1 production and cellular antiviral response by promoting 'Lys-48'-linked polyubiquitination of TNK1 leading to its proteasomal degradation. Involved in response to genotoxic lesions during genome replication. Promotes H2AX and RPA2 phosphorylation after replication-associated DNA damage and assists fork progression at UV-induced replication-blocking lesions during S phase. Has also been proposed to play a role in promoting translesion synthesis by mediating the assembly of 'Lys-63'-linked poly-ubiquitin chains on the Y-family polymerase POLN in order to facilitate bypass of DNA lesions and preserve genomic integrity. The function in translesion synthesis is controversial
References	"TRAF-interacting protein (TRIP): a novel component of the tumor necrosis factor receptor (TNFR)- and CD30-TRAF signaling complexes that inhibits TRAF2-mediated NF-kappaB activation." Lee S.Y., Lee S.Y., Choi Y. J. Exp. Med. 185:1275-1285(1997)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	E3 ubiquitin ligase acting as a negative regulator of innate immune signaling. Inhibits activation of NF-kappa-B mediated by TNF. Negatively regulates TLR3/4- and RIG-I-mediated IRF3 activation and subsequent IFNB1 production and cellular antiviral response by promoting 'Lys-48'-linked polyubiquitination of TNK1 leading to its proteasomal degradation (By similarity)
Involvement in disease	Seckel syndrome 9 (SCKL9)
Subcellular Location	Cytoplasm, Cytoplasm, perinuclear region, Nucleus, Nucleus, nucleolus
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time