Item no. |
CSB-EP860653HU-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Colon and small intestine-specific cysteine-rich protein,Colon carcinoma-related gene protein,Cysteine-rich secreted protein A12-alpha-like 1,Cysteine-rich secreted protein FIZZ2,RELMbeta |
Available |
|
Research Topic |
Others |
Uniprot ID |
Q9BQ08 |
Gene Names |
RETNLB |
Organism |
Homo sapiens (Human) |
AA Sequence |
QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASV KSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTC HCQCSVVDWTTARCCHLT |
Expression Region |
24-111aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-tagged |
MW |
13.4 kDa |
Alternative Name(s) |
Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta |
Relevance |
Probable hormone. |
Reference |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Probable hormone. |
Subcellular Location |
Secreted |
Protein Families |
Resistin/FIZZ family |
Tissue Specificity |
Expressed only in the gastrointestinal tract, particularly the colon. |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.