« Back
Home /
Recombinant Chicken anemia virus Apoptin(VP3)

Recombinant Chicken anemia virus Apoptin(VP3)

Item no.	CSB-EP860325CID-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	Q99152
Gene Names	VP3
Organism	Chicken anemia virus (isolate Germany Cuxhaven-1) (CAV)
AA Sequence	MNALQEDTPPGPSTVFRPPTSSRPLETPHCREIRI GIAGITITLSLCGCANARAPTLRSATADNSESTGF KNVPDLRTDQPKPPSKKRSCDPSEYRVSELKESLI TTTPSRPRTAKRRIRL
Expression Region	1-121aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	29.3 kDa
Relevance	May act as transcriptional regulator. Induces apoptosis in infected cells. Element of infectious replication cycle.
Reference	"Characterization of cloned chicken anemia virus DNA that contains all elements for the infectious replication cycle."Noteborn M.H.M., de Boer G.F., van Roozelaar D.J., Karreman C., Kranenburg O., Vos J.G., Jeurissen S.H.M., Hoeben R.C., Zantema A., Koch G., van Ormondt H., van der Eb A.J.J. Virol. 65:3131-3139(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May act as transcriptional regulator. Induces apoptosis in infected cells. Element of infectious replication cycle.
Subcellular Location	Host nucleus
Protein Families	Gyrovirus apoptin family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time