Item no. |
CSB-EP857767HU-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Mitogen-activated protein kinase 2-associated protein 1,Stress-activated map kinase-interacting protein 1,Short name:,SAPK-interacting protein 1,Short name:,mSIN1 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
Q9BPZ7 |
Gene Names |
MAPKAP1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
AFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDV DLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSVD ITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNI QWKERNSKQSAQELKSLFEKKSLKEKPPISGKQSI LSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKK IDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLIC WQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFP PLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLFV RINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQ KVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFCL VRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSF KVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAST KFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLT YLSNHDYKHLYFESDAATVNEIVLKVNYILESRAS TARADYFAQKQRKLNRRTSFSFQKEKKSGQQ |
Expression Region |
2-522aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
75 kDa |
Alternative Name(s) |
Mitogen-activated protein kinase 2-associated protein 1 Stress-activated map kinase-interacting protein 1 Short name: SAPK-interacting protein 1 Short name: mSIN1 |
Relevance |
Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. Within mTORC2, MAPKAP1 is required for complex formation and mTORC2 kinase activity. MAPKAP1 inhibits MAP3K2 by preventing its dimerization and autophosphorylation. Inhibits HRAS and KRAS signaling. Enhances osmotic stress-induced phosphorylation of ATF2 and ATF2-mediated transcription. Involved in ciliogenesis, regulates cilia length through its interaction with CCDC28B independently of mTORC2 complex. |
Reference |
"Alternative polyadenylation and splicing of mRNAs transcribed from the human Sin1 gene."Schroder W., Cloonan N., Bushell G., Sculley T. Gene 339:17-23(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. Within mTORC2, MAPKAP1 is required for complex formation and mTORC2 kinase activity. MAPKAP1 inhibits MAP3K2 by preventing its dimerization and autophosphorylation. Inhibits HRAS and KRAS signaling. Enhances osmotic stress-induced phosphorylation of ATF2 and ATF2-mediated transcription. Involved in ciliogenesis, regulates cilia length through its interaction with CCDC28B independently of mTORC2 complex. |
Subcellular Location |
Cell membrane, Peripheral membrane protein, Cytoplasmic vesicle, Nucleus |
Protein Families |
SIN1 family |
Tissue Specificity |
Ubiquitously expressed, with highest levels in heart and skeletal muscle. |
Paythway |
mTORsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.