« Back
Home /
Recombinant Human Protein Wnt-2b(WNT2B)

Recombinant Human Protein Wnt-2b(WNT2B)

Item no.	CSB-EP856613HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Alternative Name(s)	Protein Wnt-13
AA Sequence	MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRA SARLGLACLLLLLLLTLPARVDTSWWYIGALGARV ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIR ECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAA FVYAISSAGVVHAITRACSQGELSVCSCDPYTRGR HHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRL KDARALMNLHNNRCGRTAVRRFLKLECKCHGVSGS CTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQD GANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAA GSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVT RVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKA EWLDQT
Research Topic	Cancer
Uniprot ID	Q93097
Gene Names	WNT2B
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-391aa
MW of Fusion Proten	59, 8
Sequence Info	Full Length
Relevance	Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. May be involved in normal development or differentiation as well as in carcinogenesis.
Reference	"Cloning, expression and chromosomal localization of Wnt-13, a novel member of the Wnt gene family."Katoh M., Hirai M., Sugimura T., Terada M.Oncogene 13:873-876(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

not available