« Back
Home /
Recombinant Human Glycerol-3-phosphate dehydrogenase 1-like protein(GPD1L) (Active)

Recombinant Human Glycerol-3-phosphate dehydrogenase 1-like protein(GPD1L) (Active)

Item no.	CSB-EP854029HU-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	GST
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Cell Biology
Uniprot NO.	Q8N335
Gene Names	GPD1L
Source	E.coli
Expression Region	1-351aa
Sequence	MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFA STVKMWVFEETVNGRKLTDIINNDHENVKYLPGHK LPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICD EITGRVPKKALGITLIKGIDEGPEGLKLISDIIRE KMGIDISVLMGANIANEVAAEKFCETTIGSKVMEN GLLFKELLQTPNFRITVVDDADTVELCGALKNIVA VGAGFCDGLRCGDNTKAAVIRLGLMEMIAFARIFC KGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQK GLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEH
Protein Description	Full Length
Tag Info	N-terminal GST-tagged
Mol. Weight	65.4 kDa
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized CCL5 at 2 ug/ml can bind human GPD1L, the EC50 of human GPD1L protein is 47.34-66.33 ug/ml.
Purity	Greater than 85% as determined by SDS-PAGE.
Endotoxin	Not test.
Storage Buffer	Tris-based buffer, 50% glycerol
Alias	KIAA0089
Relevance	Plays a role in regulating cardiac sodium current; decreased enzymatic activity with resulting increased levels of glycerol 3-phosphate activating the DPD1L-dependent SCN5A phosphorylation pathway, may ultimately lead to decreased sodium current; cardiac sodium current may also be reduced due to alterations of NAD(H) balance induced by DPD1L.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time