Comparison

Recombinant Human DENN domain-containing protein 1A(DENND1A)

Item no. CSB-EP823472HU-100
Manufacturer Cusabio
Amount 100ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human
Host E.coli
Purity Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Connecdenn 1 ;Connecdenn;Protein FAM31A
Available
Research Areas
Neuroscience
Target / Protein
DENND1A
Biologically Active
Not Test
Expression System
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
Q8TEH3
AA Sequence
MGSRIKQNPETTFEVYVEVAYPRTGGTLSDPEVQR QFPEDYSDQEVLQTLTKFCFPFYVDSLTVSQVGQN FTFVLTDIDSKQRFGFCRLSSGAKSCFCILSYLPW FEVFYKLLNILADYTTKRQENQWNELLETLHKLPI PDPGVSVHLSVHSYFTVPDTRELPSIPENRNLTEY FVAVDVNNMLHLYASMLYERRILIICSKLSTLTAC IHGSAAMLYPMYWQHVYIPVLPPHLLDYCCAPMPY LIGIHLSLMEKVRNMALDDVVILNVDTNTLETPFD DLQSLPNDVISSLKNRLKKVSTTTGDGVARAFLKA QAAFFGSYRNALKIEPEEPITFCEEAFVSHYRSGA MRQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVF EEEINMGEYAGSDKLYHQWLSTVRKGSGAILNTVK TKANPAMKTVYKFAKDHAKMGIKEVKNRLKQKDIA ENGCAPTPEEQLPKTAPSPLVEAKDPKLREDRRPI TVHFGQVRPPRPHVVKRPKSNIAVEGRRTSVPSPE QNTIATPATLHILQKSITHFAAKFPTRGWTSSSH
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-559aa
Protein Length
Full Length of Isoform 2
MW
79.4 kDa
Alternative Name(s)
Connecdenn 1 ; Connecdenn; Protein FAM31A
Relevance
Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles.
Reference
Complete sequencing and characterization of 21, 243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Guanine nucleotide exchange factor (GEF) regulating clathrin-mediated endocytosis through RAB35 activation. Promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB35 into its active GTP-bound form. Regulates clathrin-mediated endocytosis of synaptic vesicles and mediates exit from early endosomes
Involvement in disease
Genetic variants in DENND1A may play a role in susceptibility to polycystic ovary syndrome (PCOS), the most common endocrine disease among premenopausal women. PCOS is a complex disorder characterized by infertility, hirsutism, obesity, various menstrual disturbances, and enlarged ovaries studded with atretic follicles.
Subcellular Location
Cytoplasmic vesicle, clathrin-coated vesicle membrane, Peripheral membrane protein, Cell junction, synapse, presynaptic cell membrane
Tag Information
N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close