« Back
Home /
Recombinant Human RING finger and CHY zinc finger domain-containing protein 1(RCHY1)

Recombinant Human RING finger and CHY zinc finger domain-containing protein 1(RCHY1)

Item no.	CSB-EP822281HU-100
Manufacturer	Cusabio
Amount	100ug
Category	Oncology Neuroscience Aging & Neurological Disorders Neural Epigenetics Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Hepatic Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Androgen receptor N-terminal-interacting protein,CH-rich-interacting match with PLAG1,E3 ubiquitin-protein ligase Pirh2,RING finger protein 199,Zinc finger protein 363,p53-induced RING-H2 protein
Available
Research Areas	Cell Biology
Uniprot ID	Q96PM5
Gene Names	RCHY1
Organism	Homo sapiens (Human)
AA Sequence	MAATAREDGASGQERGQRGCEHYDRGCLLKAPCCD KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQH AQQTCEECSTLFGEYYCDICHLFDKDKKQYHCENC GICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENV SRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEE MLKEGYRCPLCMHSALDMTRYWRQLDDEVAQTPMP SEYQNMTVDILCNDCNGRSTVQFHILGMKCKICES YNTAQAGGRRISLDQQ
Expression Region	1-261aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	57.1 kDa
Alternative Name(s)	Androgen receptor N-terminal-interacting protein CH-rich-interacting match with PLAG1 E3 ubiquitin-protein ligase Pirh2 RING finger protein 199 Zinc finger protein 363 p53-induced RING-H2 protein
Relevance	Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, P73, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Monoubiquitinates the translesion DNA polymerase POLH. Contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity.
Reference	A novel hPirh2 splicing variant without ubiquitin protein ligase activity interacts with p53 and is down-regulated in hepatocellular carcinoma. Wu G., Sun M., Zhang L., Zhou J., Wang Y., Huo K. FEBS Lett. 584:2772-2778(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, P73, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Monoubiquitinates the translesion DNA polymerase POLH. Contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity.
Subcellular Location	Nucleus, Nucleus speckle, Cytoplasm
Paythway	p53signalingpathway
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time