« Back
Home /
Recombinant Salmonella typhi Universal stress protein A(uspA)

Recombinant Salmonella typhi Universal stress protein A(uspA)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP820596SWW-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 90% as determined by SDS-PAGE.
Research areas	Microbiology
Target / Protein	uspA
Biologically active	Not Test
Expression system	E.coli
Species of origin	Salmonella typhi
Uniprot ID	Q8Z268
AA Sequence	AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISL IHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALT ELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDL VVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRD EEE
Tag Info	N-terminal 6xHis-tagged
Expression Region	2-144aa
Protein length	Full Length of Mature Protein
MW	19.9 kDa
Relevance	Required for resistance to DNA-damaging agents.
References	"Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18."Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003) .
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required for resistance to DNA-damaging agents.
Subcellular Location	Cytoplasm
Protein Families	Universal stress protein A family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time