« Back
Home /
Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5(ABHD5)

Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase ABHD5(ABHD5)

Item no.	CSB-EP819884HU-500
Manufacturer	Cusabio
Amount	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Oncology Metabolism Diabetes Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Abhydrolase domain-containing protein 5,Lipid droplet-binding protein CGI-58
Available
Research Topic	Cancer
Uniprot ID	Q8WTS1
Gene Names	ABHD5
Organism	Homo sapiens (Human)
AA Sequence	AAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLK EAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHN ISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYA FDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCA LGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILV EPWGFPERPDLADQDRPIPVWIRALGAALTPFNPL AGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVT EYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRI GKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSY VKTIAILGAGHYVYADQPEEFNQKVKEICDTVD
Expression Region	2-349aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	55 kDa
Alternative Name(s)	Abhydrolase domain-containing protein 5 Lipid droplet-binding protein CGI-58
Relevance	Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation.
Reference	"Mutations in CGI-58, the gene encoding a new protein of the esterase/lipase/thioesterase subfamily, in Chanarin-Dorfman syndrome."Lefevre C., Jobard F., Caux F., Bouadjar B., Karaduman A., Heilig R., Lakhdar H., Wollenberg A., Verret J.-L., Weissenbach J., Oezguec M., Lathrop M., Prud'homme J.-F., Fischer J.Am. J. Hum. Genet. 69:1002-1012(2001)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis
Involvement in disease	Chanarin-Dorfman syndrome (CDS)
Subcellular Location	Cytoplasm, Lipid droplet
Protein Families	Peptidase S33 family, ABHD4/ABHD5 subfamily
Tissue Specificity	Widely expressed in various tissues, including lymphocytes, liver, skeletal muscle and brain. Expressed by upper epidermal layers and dermal fibroblasts in skin, hepatocytes and neurons (at protein level).
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP819884HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time