Item no. |
CSB-EP819884HU-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Quantity options |
1mg
10ug
100ug
20ug
200ug
50ug
500ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Abhydrolase domain-containing protein 5,Lipid droplet-binding protein CGI-58 |
Available |
|
Research Areas |
Cancer |
Uniprot ID |
Q8WTS1 |
Gene Names |
ABHD5 |
Organism |
Homo sapiens (Human) |
AA Sequence |
AAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLK EAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSHN ISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYA FDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCA LGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILV EPWGFPERPDLADQDRPIPVWIRALGAALTPFNPL AGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVT EYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRI GKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSY VKTIAILGAGHYVYADQPEEFNQKVKEICDTVD |
Expression Region |
2-349aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
55 kDa |
Alternative Name(s) |
Abhydrolase domain-containing protein 5 Lipid droplet-binding protein CGI-58 |
Relevance |
Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. |
Reference |
Mutations in CGI-58, the gene encoding a new protein of the esterase/lipase/thioesterase subfamily, in Chanarin-Dorfman syndrome.Lefevre C., Jobard F., Caux F., Bouadjar B., Karaduman A., Heilig R., Lakhdar H., Wollenberg A., Verret J.-L., Weissenbach J., Oezguec M., Lathrop M., Prud'homme J.-F., Fischer J.Am. J. Hum. Genet. 69:1002-1012(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis |
Involvement in disease |
Chanarin-Dorfman syndrome (CDS) |
Subcellular Location |
Cytoplasm, Lipid droplet |
Protein Families |
Peptidase S33 family, ABHD4/ABHD5 subfamily |
Tissue Specificity |
Widely expressed in various tissues, including lymphocytes, liver, skeletal muscle and brain. Expressed by upper epidermal layers and dermal fibroblasts in skin, hepatocytes and neurons (at protein level). |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.