« Back
Home /
Recombinant Human Tomoregulin-1(TMEFF1),partial

Recombinant Human Tomoregulin-1(TMEFF1),partial

Item no.	CSB-EP818263HUa0-1
Manufacturer	Cusabio
Amount	1mg
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Human
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Target / Protein	TMEFF1
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q8IYR6
AA Sequence	SNQPPGGGGGSGGDCPGGKGKSINCSELNVRESDV RVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIP VCGSNGDTYQNECFLRRAACKHQKEITVIARGPCY SDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAEC DEDAENVGCVCNIDCSGYSFNPVCASDGSSYNNPC FVREASCIKQEQIDIRHLGHCTDTDDTSLLGKKDD GLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCI HGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILY VVPSRQKLTHV
Tag Info	N-terminal 6xHis-tagged
Expression Region	40-330aa
Protein Length	Partial
MW	35.5 kDa
Alternative Name(s)	H7365 Transmembrane protein with EGF-like and one follistatin-like domain C9orf2
Relevance	May inhibit NODAL and BMP signaling during neural patterning. May be a tumor suppressor in brain cancers.
Reference	A novel transmembrane protein with epidermal growth factor and follistatin domains expressed in the hypothalamo-hypophysial axis of Xenopus laevis. Eib D.W., Martens G.J.M. J. Neurochem. 67:1047-1055(1996)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May inhibit NODAL and BMP signaling during neural patterning (By similarity). May be a tumor suppressor in brain cancers.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Protein Families	Tomoregulin family
Tissue Specificity	Expressed predominantly in brain, and at lower levels in heart, placenta and skeletal muscle. Down-regulated in brain tumors as compared to control brain tissues.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time