« Back
Home /
Recombinant Human Methionine-R-sulfoxide reductase B3(MSRB3)

Recombinant Human Methionine-R-sulfoxide reductase B3(MSRB3)

Item no.	CSB-EP810290HU-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Signal Transduction
Uniprot ID	Q8IXL7
Gene Names	MSRB3
Organism	Homo sapiens (Human)
AA Sequence	MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCK VVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTH HKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDV INSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFD DGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVA SPAQADKAEL
Expression Region	1-185aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	47 kDa
Relevance	Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.
Reference	"Methionine sulfoxide reduction in mammals: characterization of methionine-R-sulfoxide reductases." Kim H.-Y., Gladyshev V.N. Mol. Biol. Cell 15:1055-1064(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.
Involvement in disease	Deafness, autosomal recessive, 74 (DFNB74)
Subcellular Location	Isoform 1: Endoplasmic reticulum, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion
Protein Families	MsrB Met sulfoxide reductase family
Tissue Specificity	Widely expressed.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time