« Back
Home /
Recombinant Mouse RNA binding protein fox-1 homolog 3 (Rbfox3)

Recombinant Mouse RNA binding protein fox-1 homolog 3 (Rbfox3)

Item no.	CSB-EP806847MO-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	Q8BIF2
Gene Names	Rbfox3
Organism	Mus musculus (Mouse)
AA Sequence	MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSG QTPVPPEHGMTLYTPAQTHPEQPGTEASTQPIAGT QTVPQADEAAQTDNQQLHPSDPTEKQQPKRLHVSN IPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGF GFVTFETSSDADRAREKLNGTIVEGRKIEVNNATA RVMTNKKPGNPYANGWKLNPVVGTVYGPEFYAVTS FPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPP PIPTYGAALEQTLVKMPVPWAGLAPCPLPPQQTPE PAYPTSPAFPPLSCPFASRVVYQDGFYGAEIYGGY AAYRYAQPAAATAAAYSDSYGRVYAAADPYHHTIG PTATYSIGTMASLCRGGYSRFTPY
Expression Region	1-374aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	47.6 kDa
Alternative Name(s)	Fox-1 homolog C (Hexaribonucleotide-binding protein 3) (Fox-3) (Neuronal nuclei antigen) (NeuN antigen) (D11Bwg0517e) (Hrnbp3)
Relevance	Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD)
Reference	"NeuN/Rbfox3 nuclear and cytoplasmic isoforms differentially regulate alternative splicing and nonsense-mediated decay of Rbfox2." Dredge B.K., Jensen K.B. PLoS ONE 6:E21585-E21585(2011)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Pre-mRNA alternative splicing regulator. Regulates alternative splicing of RBFOX2 to enhance the production of mRNA species that are targeted for nonsense-mediated decay (NMD).
Subcellular Location	Nucleus, Cytoplasm, SUBCELLULAR LOCATION: Isoform 1: Nucleus, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm, SUBCELLULAR LOCATION: Isoform 5: Nucleus
Tissue Specificity	Widely expressed in brain, including in cerebral cortex, hippocampus, thalamus, caudate/putamen, cerebellum, as well as in the spinal cord (at protein level). Not expressed in all neuronal cells within a region, in cerebellum, expression is absent in Purkinje cells (at protein level). Expressed in the retina in the ganglion cells and some cells in the inner nuclear layer, but absent from the photoreceptor cells and most cells in the inner nuclear layer (at protein level).
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time