« Back
Home /
Recombinant Mycobacterium paratuberculosis DNA integrity scanning protein DisA(disA)

Recombinant Mycobacterium paratuberculosis DNA integrity scanning protein DisA(disA)

Item no.	CSB-EP762077MLA-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	Others
Target / Protein	disA
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Uniprot ID	Q743W9
AA Sequence	MTRPTLRETVARLAPGTGLRDGLERILRGRTGALI VLGNDENVEAICDGGFALDVRYAPTRLRELAKMDG AVVLSTDGSRIVRANVQLVPDPSIATDESGTRHRS AERAAIQTGYPVISVSHSMNIVTVYVGGERHVVAD SATILSRANQAIATLERYKIRLDEVSRQLSRAEIE DFVTLRDVLTVVQRLELVRRIGQVIDNDVVELGTD GRQLRLQLDELLGGNDNARELIVRDYHASPEQLSE AQMTATLDELDALSDTELLDFTALAKVFGYPTTTE AQDSAVSPRGYRALAGIPRLQFAHADLLVRSFGTL QNVLAASASDLQSIDGIGAMWARHVREGLSQLAES TITDSLS
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	1-357aa
Protein Length	Full Length
MW	45.9 kDa
Alternative Name(s)	Cyclic di-AMP synthase (c-di-AMP synthase) (Diadenylate cyclase)
Relevance	Participates in a DNA-damage check-point. DisA forms globular foci that rapidly scan along the chromosomes searching for lesions. Has also diadenylate cyclase activity, catalyzing the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP likely acts as a signaling molecule that may couple DNA integrity with a cellular process.
Reference	The complete genome sequence of Mycobacterium avium subspecies paratuberculosis. Li L., Bannantine J.P., Zhang Q., Amonsin A., May B.J., Alt D., Banerji N., Kanjilal S., Kapur V. Proc. Natl. Acad. Sci. U.S.A. 102:12344-12349(2005)
Purity	Greater than 85% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Participates in a DNA-damage check-point. DisA forms globular foci that rapidly scan along the chromosomes searching for lesions.
Protein Families	DisA family
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time