« Back
Home /
Recombinant Mouse Mucosal addressin cell adhesion molecule 1(Madcam1),partial

Recombinant Mouse Mucosal addressin cell adhesion molecule 1(Madcam1),partial

Item no.	CSB-EP717229MO-1
Manufacturer	Cusabio
Amount	1mg
Category	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Short name:,MAdCAM-1,Short name:,mMAdCAM-1
Available
Research Areas	Immunology
Uniprot ID	Q61826
Gene Names	Madcam1
Organism	Mus musculus (Mouse)
AA Sequence	QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARV HWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVC VGSCGSRSFQHSVKILVYAFPDQLVVSPEFLVPGQ DQVVSCTAHNIWPADPNSLSFALLLGEQRLEGAQA LEPEQEEEIQEAEGTPLFRMTQRWRLPSLGTPAPP ALHCQVTMQLPKLVLTHRKEIPVLQSQTSPKPPNT TSAEPYILTSSSTAEAVSTGLNITTLPSAPPYPKL SPRTLSSEGPCRPKIHQDLEAGWELLCEASCGPGV TVRWTLAPGDLATYHKREAGAQAWLSVLPPGPMVE GWFQCRQDPGGEVTNLYVPGQVTPNSSS
Expression Region	22-364aa
Sequence Info	Extracellular Domain
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	52.8 kDa
Alternative Name(s)	Short name: MAdCAM-1 Short name: mMAdCAM-1
Relevance	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Both isoform 1 and isoform 2 can adhere to integrin alpha-4/beta-7. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Reference	MAdCAM-1 has homology to immunoglobulin and mucin-like adhesion receptors and to IgA1.Briskin M.J., McEvoy L.M., Butcher E.C.Nature 363:461-464(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes. Both isoform 1 and isoform 2 can adhere to integrin alpha-4/beta-7. Isoform 2, lacking the mucin-like domain, may be specialized in supporting integrin alpha-4/beta-7-dependent adhesion strengthening, independent of L-selectin binding.
Involvement in disease	Absence of Madcam1 in the spleen has been found in aly/aly mice, but normal expression is found in intestinal venules. This aberrant expression is a secondary defect and not the direct cause of aly alymphoplasia, an autosomal recessive mutation which induces total aplasia of lymph nodes and Peyer patches.
Subcellular Location	Membrane, Single-pass type I membrane protein
Tissue Specificity	Highly expressed on high endothelial venules (HEV) of organized intestinal lymphoid tissues like the Peyer patches and mesenteric lymph nodes, and in the lamina propria of the intestine. Some expression found in the spleen, and low levels of expression in the peripheral lymph nodes and the lactating mammary gland. No expression was detected in the liver, kidneys, lungs or in normal brain. Expressed as well in brain endothelioma cells, and mucosal tissues which are in a chronic state of inflammation, such as inflammed pancreas.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP717229MO-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time