Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
200ug |
Host |
E.coli |
Item no. |
CSB-EP706382NGS-200 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Purity |
Greater than 90% as determined by SDS-PAGE. |
Research Topic |
Microbiology |
Uniprot ID |
Q4WT66 |
Gene Names |
NRPS1 |
Organism |
eosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
AA Sequence |
LSPIQKLHFMVRKEGQGYFNQSVVTRIDRQINDQD MRRAVEAVVMRHSMLRSRLVDPSTGNSLQLRITED VAGSYRWRTHYMTAQNEIENAIAESQLCINAFVGP VFAVDFCYVDEDSHNLLSLVAHHLVVDIVSWRIIL EDLEDFLLNPQGFVLQNSSLPFQTWCRLQDEQCES VAFENDVQLEDLPAPDLAYWGMEHRQMTYGDVICE TFELDPGSTQSILLECHQSLRTEPVDLFLAALVHS FGQTFPERTLPVIYNEGHGREVWDSSLDISRTVGW FTTLYPIFVQEIVSEDPARTVARVKDLRRQVSDNG RQKFASRMFTGKGQQTCRHHYPLEMTFNYVGQHRD LQKQDGLFQLMGHMAGEAGQGGGAADFGEETPRFA LLEISALVVQGQLRFTFSFNRFMRHQSGIHAWISR CHQLLASLGQKLQSLAPQPTLSDFPMLSL |
Expression Region |
894-1342aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
67.2 kDa |
Relevance |
Nonribosomal peptide synthesis (NRPS) is a key mechanism responsible for the biosynthesis of bioactive metabolites which are potentially contributing to organismal virulence. Contributes to improved fungal tolerance against oxidative stress, during the infection process. |
Reference |
"Phylogenomic analysis of non-ribosomal peptide synthetases in the genus Aspergillus."Cramer R.A. Jr., Stajich J.E., Yamanaka Y., Dietrich F.S., Steinbach W.J., Perfect J.R.Gene 383:24-32(2006) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Nonribosomal peptide synthesis (NRPS) is a key mechanism responsible for the biosynthesis of bioactive metabolites which are potentially contributing to organismal virulence. Contributes to improved fungal tolerance against oxidative stress, during the infection process. |
Protein Families |
NRP synthase family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.