« Back
Home /
Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic(LCY1)

Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic(LCY1)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP657129DOA-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 90% as determined by SDS-PAGE.
Research Topic	Others
Uniprot ID	Q38933
Gene Names	LCY1
Organism	Arabidopsis thaliana (Mouse-ear cress)
AA Sequence	QVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSP KLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYV DEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKF HQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATG FSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDK MVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSS NRIFLEETSLVARPGLRMEDIQERMAARLKHLGIN VKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMV HPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLR GDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLD LDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVF GLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDR
Expression Region	81-501aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	63.1 kDa
Relevance	Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene.
Reference	Functional analysis of the beta and epsilon lycopene cyclase enzymes of Arabidopsis reveals a mechanism for control of cyclic carotenoid formation.Cunningham F.X. Jr., Pogson B., Sun Z., McDonald K.A., Dellapenna D., Gantt E.Plant Cell 8:1613-1626(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in carotenoid biosynthesis. Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene
Subcellular Location	Plastid, chloroplast
Protein Families	Lycopene cyclase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time