« Back
Home /
Recombinant Human Core-binding factor subunit beta(CBFB)

Recombinant Human Core-binding factor subunit beta(CBFB)

Item no.	CSB-EP623835HU-100
Manufacturer	Cusabio
Amount	100ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Neural Development Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Polyomavirus enhancer-binding protein 2 beta subunit ;PEA2-beta ;PEBP2-beta;SL3-3 enhancer factor 1 subunit beta;SL3/AKV core-binding factor beta subunit
Available
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q13951
Gene Names	CBFB
Organism	Homo sapiens (Human)
AA Sequence	MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDR PHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNG VCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVT GKKTTRP
Expression Region	1-182aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	37.5 kDa
Alternative Name(s)	Polyomavirus enhancer-binding protein 2 beta subunit ; PEA2-beta ; PEBP2-beta; SL3-3 enhancer factor 1 subunit beta; SL3/AKV core-binding factor beta subunit
Relevance	CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
Reference	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. CBFB enhances DNA binding by RUNX1.
Involvement in disease	A chromosomal aberration involving CBFB is associated with acute myeloid leukemia of M4EO subtype. Pericentric inversion inv(16)(p13; q22). The inversion produces a fusion protein that consists of the 165 N-terminal residues of CBF-beta (PEPB2) with the tail region of MYH11.
Subcellular Location	Nucleus
Protein Families	CBF-beta family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP623835HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time