Comparison

Recombinant Human POU domain, class 4, transcription factor 2(POU4F2)

Item no. CSB-EP622514HU-100
Manufacturer Cusabio
Amount 100ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag Myc
Purity Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Research Areas
Others
Uniprot ID
Q12837
Gene Names
POU4F2
Organism
Homo sapiens (Human)
AA Sequence
MNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHH HHHQPHQALEGELLEHLSPGLALGAMAGPDGAVVS TPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMS DVDADPRDLEAFAERFKQRRIKLGVTQADVGSALA NLKIPGVGSLSQSTICRFESLTLSHNNMIALKPIL QAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAA PEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVV RVWFCNQRQKQKRMKYSAGI
Expression Region
1-265aa
Sequence Info
Full Length of Isoform 2
Source
E.coli
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
36.0 kDa
Alternative Name(s)
Brain-specific homeobox/POU domain protein 3B (Brain-3B) (Brn-3B) (BRN3B)
Relevance
DNA-binding transcriptional regulator and coregulator that recognizes and binds to the consensus octamer binding site 5'-AT[A/T]A[T/A]T[A/T]A-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell differentiation. Cooperates with the transcription factor ISL1 to achieve RGC fate specification in the developing retina. Plays also a role in RGC axon formation and guidance by regulating gene expression of specific target genes. Plays a role in TNFSF11-mediated terminal osteoclast differentiation. Binds chromatin at promoter region of target genes.Isoform 1: Acts either as a transcriptional activator or repressor. Negatively regulates transcriptional activity of homeobox domain transcriptional factors DLX1 and DLX2, and hence prevents DLX1- and DLX2-mediated ability to promote amacrine cells specification. Involved in the positive regulation of the transcriptional factor PAX6 expression through its binding to the neuroretina-specific enhancer in neuroretina cells. Mediates positive transcriptional regulation of heat shock protein HSPB1 expression in cardiac myocytes. Positively regulates POU4F1 expression by interacting directly with a highly conserved autoregulatory domain surrounding the transcription initiation site of the POU4F1 gene promoter. Plays a role in the regulation of breast cancer cell growth by promoting transcription activation as well as repression of specific target genes. Involved in tumor breast progression and invasion. Stimulates the promoter activity of the GTP-binding protein RIT2 gene containing the octamer binding site in retinal ganglion cells. Plays also a role either as a transcriptional coactivator or corepressor. Transcriptional coactivator cooperating with transcription factors ISL1 and ISL2 to potentiate transcriptional activation of retinal ganglion cell target genes. Antagonizes the transcriptional stimulatory activity of POU4F1 by preventing its binding to the octamer motif. Binds to the octamer binding site to form a ternary complex with ISL1 in promoter of target genes.Isoform 2: Acts either as a transcriptional activator or repressor. Stimulates the promoter activity of the neuronal nicotinic acetylcholine receptor alpha CHRNA2. Negatively regulates the apoptosis regulator BAX promoter activity. Inhibits promoter activity of the neuronal intermediate filament protein alpha-internexin INA gene. Plays a role in the regulation of breast cancer cell growth by promoting transcription activation as well as repression of specific target genes. Involved in tumor breast progression and invasion. Inhibits the promoter activity of the GTP-binding protein RIT2 gene containing the octamer binding site in retinal ganglion cells. Plays also a role either as transcriptional coactivator or corepressor. Transcriptional coactivator cooperating with transcription factors TP53 to potentiate transcriptional activation of BAX promoter activity, and hence increases neuronal cell apoptosis. Antagonizes the transcriptional stimulatory activity of POU4F1 by preventing its binding to the octamer motif. Acts also as a transcriptional coactivator via its interaction with the transcription factor ESR1.
Reference
Expression of the Brn-3b transcription factor correlates with expression of HSP-27 in breast cancer biopsies and is required for maximal activation of the HSP-27 promoter.
Lee S.A., Ndisang D., Patel C., Dennis J.H., Faulkes D.J., D'Arrigo C., Samady L., Farooqui-Kabir S., Heads R.J., Latchman D.S., Budhram-Mahadeo V.S.
Cancer Res. 65:3072-3080(2005)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
DNA-binding transcriptional regulator and coregulator that recognizes and binds to the consensus octamer binding site 5'-AT[A/T]A[T/A]T[A/T]A-3' in promoter of target genes
Subcellular Location
Nucleus, Nucleus speckle, Cytoplasm, Cell membrane
Protein Families
POU transcription factor family, Class-4 subfamily
Tissue Specificity
Expressed in the ganglion cell layer of the retina (PubMed:7691107). Expressed in breast cancer cell lines (at protein level) (PubMed:11526481). Expressed in the brain (PubMed:7691107). Expressed in breast cancer cell lines (PubMed:11526481).
Tag Information
N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close