Item no. |
CSB-EP622514HU-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Conjugate/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Areas |
Others |
Uniprot ID |
Q12837 |
Gene Names |
POU4F2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHH HHHQPHQALEGELLEHLSPGLALGAMAGPDGAVVS TPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMS DVDADPRDLEAFAERFKQRRIKLGVTQADVGSALA NLKIPGVGSLSQSTICRFESLTLSHNNMIALKPIL QAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAA PEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVV RVWFCNQRQKQKRMKYSAGI |
Expression Region |
1-265aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
36.0 kDa |
Alternative Name(s) |
Brain-specific homeobox/POU domain protein 3B (Brain-3B) (Brn-3B) (BRN3B) |
Relevance |
DNA-binding transcriptional regulator and coregulator that recognizes and binds to the consensus octamer binding site 5'-AT[A/T]A[T/A]T[A/T]A-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell differentiation. Cooperates with the transcription factor ISL1 to achieve RGC fate specification in the developing retina. Plays also a role in RGC axon formation and guidance by regulating gene expression of specific target genes. Plays a role in TNFSF11-mediated terminal osteoclast differentiation. Binds chromatin at promoter region of target genes.Isoform 1: Acts either as a transcriptional activator or repressor. Negatively regulates transcriptional activity of homeobox domain transcriptional factors DLX1 and DLX2, and hence prevents DLX1- and DLX2-mediated ability to promote amacrine cells specification. Involved in the positive regulation of the transcriptional factor PAX6 expression through its binding to the neuroretina-specific enhancer in neuroretina cells. Mediates positive transcriptional regulation of heat shock protein HSPB1 expression in cardiac myocytes. Positively regulates POU4F1 expression by interacting directly with a highly conserved autoregulatory domain surrounding the transcription initiation site of the POU4F1 gene promoter. Plays a role in the regulation of breast cancer cell growth by promoting transcription activation as well as repression of specific target genes. Involved in tumor breast progression and invasion. Stimulates the promoter activity of the GTP-binding protein RIT2 gene containing the octamer binding site in retinal ganglion cells. Plays also a role either as a transcriptional coactivator or corepressor. Transcriptional coactivator cooperating with transcription factors ISL1 and ISL2 to potentiate transcriptional activation of retinal ganglion cell target genes. Antagonizes the transcriptional stimulatory activity of POU4F1 by preventing its binding to the octamer motif. Binds to the octamer binding site to form a ternary complex with ISL1 in promoter of target genes.Isoform 2: Acts either as a transcriptional activator or repressor. Stimulates the promoter activity of the neuronal nicotinic acetylcholine receptor alpha CHRNA2. Negatively regulates the apoptosis regulator BAX promoter activity. Inhibits promoter activity of the neuronal intermediate filament protein alpha-internexin INA gene. Plays a role in the regulation of breast cancer cell growth by promoting transcription activation as well as repression of specific target genes. Involved in tumor breast progression and invasion. Inhibits the promoter activity of the GTP-binding protein RIT2 gene containing the octamer binding site in retinal ganglion cells. Plays also a role either as transcriptional coactivator or corepressor. Transcriptional coactivator cooperating with transcription factors TP53 to potentiate transcriptional activation of BAX promoter activity, and hence increases neuronal cell apoptosis. Antagonizes the transcriptional stimulatory activity of POU4F1 by preventing its binding to the octamer motif. Acts also as a transcriptional coactivator via its interaction with the transcription factor ESR1. |
Reference |
Expression of the Brn-3b transcription factor correlates with expression of HSP-27 in breast cancer biopsies and is required for maximal activation of the HSP-27 promoter. Lee S.A., Ndisang D., Patel C., Dennis J.H., Faulkes D.J., D'Arrigo C., Samady L., Farooqui-Kabir S., Heads R.J., Latchman D.S., Budhram-Mahadeo V.S. Cancer Res. 65:3072-3080(2005) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
DNA-binding transcriptional regulator and coregulator that recognizes and binds to the consensus octamer binding site 5'-AT[A/T]A[T/A]T[A/T]A-3' in promoter of target genes |
Subcellular Location |
Nucleus, Nucleus speckle, Cytoplasm, Cell membrane |
Protein Families |
POU transcription factor family, Class-4 subfamily |
Tissue Specificity |
Expressed in the ganglion cell layer of the retina (PubMed:7691107). Expressed in breast cancer cell lines (at protein level) (PubMed:11526481). Expressed in the brain (PubMed:7691107). Expressed in breast cancer cell lines (PubMed:11526481). |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.