« Back
Home /
Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Recombinant Human Glutamate receptor ionotropic, NMDA 2A(GRIN2A),partial

Item no.	CSB-EP618634HU1-500
Manufacturer	Cusabio
Amount	500ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Transport
Uniprot ID	Q12879
Gene Names	GRIN2A
Organism	Homo sapiens (Human)
AA Sequence	VYQRAVMAVGSLTINEERSEVVDFSVPFVETGISV MVSRSNGTVSPSAFLIGKAIWLLWGLVFNNSVPVQ NPKGTTSKIMMHQYMTKFNQKGVEDALVSLKTGKL DAFIYDAAVLNYKAGRDEGCKLVTI
Expression Region	23-555aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	18.2 kDa
Alternative Name(s)	Glutamate [NMDA] receptor subunit epsilon-1N-methyl D-aspartate receptor subtype 2A ; NMDAR2A ; NR2A ; hNR2A
Relevance	NMDA receptor subtype of glutamate-gated ion channels possesses high calcium permeability and voltage-dependent sensitivity to magnesium. Activation requires binding of agonist to both types of subunits.
Reference	Mutations in GRIN2A and GRIN2B encoding regulatory subunits of NMDA receptors cause variable neurodevelopmental phenotypes.Endele S., Rosenberger G., Geider K., Popp B., Tamer C., Stefanova I., Milh M., Kortum F., Fritsch A., Pientka F.K., Hellenbroich Y., Kalscheuer V.M., Kohlhase J., Moog U., Rappold G., Rauch A., Ropers H.H., von Spiczak S. , Tonnies H., Villeneuve N., Villard L., Zabel B., Zenker M., Laube B., Reis A., Wieczorek D., Van Maldergem L., Kutsche K.Nat. Genet. 42:1021-1026(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+)
Involvement in disease	Epilepsy, focal, with speech disorder and with or without mental retardation (FESD)
Subcellular Location	Cell membrane, Multi-pass membrane protein, Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein
Protein Families	Glutamate-gated ion channel (TC 1.A.10.1) family, NR2A/GRIN2A subfamily
Paythway	Calciumsignalingpathway
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time