« Back
Home /
Recombinant Human Myosin-binding protein C, cardiac-type(MYBPC3),partial

Recombinant Human Myosin-binding protein C, cardiac-type(MYBPC3),partial

Item no.	CSB-EP613524HU-10
Manufacturer	Cusabio
Amount	10ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-protein, cardiac muscle isoform
Available
Research areas	Others
Target / Protein	MYBPC3
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	Q14896
AA Sequence	MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETER AGVKVRWQRGGSDISASNKYGLATEGTRHTLTVRE VGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLA PAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSA ALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFS ARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLH DSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKD KFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGG RRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEA PAEEDVWEILRQA
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-328aa
Protein length	Partial
MW	50.8 kDa
Alternative Name(s)	C-protein, cardiac muscle isoform
Relevance	Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
References	"Phosphorylation switches specific for the cardiac isoform of myosin binding protein-C: a modulator of cardiac contraction?"Gautel M., Zuffardi O., Freiburg A., Labeit S.EMBO J. 14:1952-1960(1995)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
Involvement in disease	Cardiomyopathy, familial hypertrophic 4 (CMH4); Cardiomyopathy, dilated 1MM (CMD1MM); Left ventricular non-compaction 10 (LVNC10)
Protein Families	Immunoglobulin superfamily, MyBP family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time