« Back
Home /
Recombinant Bacillus sp. Levanase,partial

Recombinant Bacillus sp. Levanase,partial

Item no.	CSB-EP523248BRG-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	2,6-beta-D-fructan fructanohydrolase,Endo-levanase
Available
Research areas	Others
Target / Protein	N/A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Bacillus sp. (strain L7)
Uniprot ID	O31411
AA Sequence	LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIA YYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHP VVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMV VSGGDHIRLFTSTNLLNWTLTDQF
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	451-579aa
Protein length	Partial
MW	30.3 kDa
Alternative Name(s)	2, 6-beta-D-fructan fructanohydrolase Endo-levanase
Relevance	Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.
References	"Characterization of a novel endo-levanase and its gene from Bacillus sp. L7."Miasnikov A.N.FEMS Microbiol. Lett. 154:23-28(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.
Subcellular Location	Secreted
Protein Families	Glycosyl hydrolase 32 family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time