Item no. |
CSB-EP467668BQP-200 |
Manufacturer |
Cusabio
|
Amount |
200ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Conjugate/Tag |
Myc |
Purity |
Greater than 85% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Research Topic |
Others |
Uniprot ID |
B7IR00 |
Gene Names |
uvsE |
Organism |
Bacillus cereus (strain G9842) |
AA Sequence |
MIMRFGYVSHAMALWDCSPAKTMTFTSFKKLSKQE REDKLYHVIRQNLEHTIRILHYNIAHEIPLYRLSS SIVPLATHPEVEFDYIGVFTPLWRKIGALIKEHNL RISFHPNQFTLFTSDKPHITTNAITDMTYHYKILD AIGIADSSYINIHVGGAYGNKEKAIERFHENIKKL PAHIKKQMTLENDDKTYTTSETLSICQKENIPFVF DYHHHMANLCEQPLEELLPAIFETWSHTNISPKVH ISSPRSEKEFRAHAEYIDLEFIKPFLHVAKKNNHN FDIMIESKQKDLALFRLIDELSAIRGIKRISGAML QW |
Expression Region |
1-317aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
44.0 kDa |
Relevance |
Component in a DNA repair pathway. Removal of UV LIGHT damaged nucleotides. Recognizes pyrimidine dimers and cleave a phosphodiester bond immediately 5' to the lesion |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component in a DNA repair pathway. Removal of UV LIGHT damaged nucleotides. Recognizes pyrimidine dimers and cleave a phosphodiester bond immediately 5' to the lesion (By similarity). |
Protein Families |
Uve1/UvsE family |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.