« Back
Home /
Recombinant Bacillus cereus UV DNA damage endonuclease(uvsE)

Recombinant Bacillus cereus UV DNA damage endonuclease(uvsE)

Item no.	CSB-EP467668BQP-200
Manufacturer	Cusabio
Amount	200ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Others
Uniprot ID	B7IR00
Gene Names	uvsE
Organism	Bacillus cereus (strain G9842)
AA Sequence	MIMRFGYVSHAMALWDCSPAKTMTFTSFKKLSKQE REDKLYHVIRQNLEHTIRILHYNIAHEIPLYRLSS SIVPLATHPEVEFDYIGVFTPLWRKIGALIKEHNL RISFHPNQFTLFTSDKPHITTNAITDMTYHYKILD AIGIADSSYINIHVGGAYGNKEKAIERFHENIKKL PAHIKKQMTLENDDKTYTTSETLSICQKENIPFVF DYHHHMANLCEQPLEELLPAIFETWSHTNISPKVH ISSPRSEKEFRAHAEYIDLEFIKPFLHVAKKNNHN FDIMIESKQKDLALFRLIDELSAIRGIKRISGAML QW
Expression Region	1-317aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW	44.0 kDa
Relevance	Component in a DNA repair pathway. Removal of UV LIGHT damaged nucleotides. Recognizes pyrimidine dimers and cleave a phosphodiester bond immediately 5' to the lesion
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Component in a DNA repair pathway. Removal of UV LIGHT damaged nucleotides. Recognizes pyrimidine dimers and cleave a phosphodiester bond immediately 5' to the lesion (By similarity).
Protein Families	Uve1/UvsE family
Tag Information	N-terminal 10xHis-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time