« Back
Home /
Recombinant Campylobacter jejuni subsp. Major cell-binding factor(peb1A)

Recombinant Campylobacter jejuni subsp. Major cell-binding factor(peb1A)

Item no.	CSB-EP379898CWF-10
Manufacturer	Cusabio
Amount	10ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CBF1,PEB1
Available
Research Topic	Microbiology
Uniprot ID	A1VZQ4
Gene Names	peb1A
Organism	Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
AA Sequence	AEGKLESIKSKGQLIVGVKNDVPHYALLDQATGEI KGFEVDVAKLLAKSILGDDKKIKLVAVNAKTRGPL LDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIG LLVLKEKNYKSLADMKGANIGVAQAATTKKAIGEA AKKIGIDVKFSEFPDYPSIKAALDAKRVDAFSVDK SILLGYVDDKSEILPDSFEPQSYGIVTKKDDPAFA KYVDDFVKEHKNEIDALAKKWGL
Expression Region	27-259aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW	45.4 kDa
Alternative Name(s)	CBF1 PEB1
Relevance	Common antigen and a major cell adherence molecule. Most probably involved, with PEB1C, in a binding-protein-dependent transport system for an amino acid. May be involved in binding to intestinal cells
Reference	"PEB1, the major cell-binding factor of Campylobacter jejuni, is a homolog of the binding component in Gram-negative nutrient transport systems."Pei Z., Blaser M.J.J. Biol. Chem. 268:18717-18725(1993)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Common antigen and a major cell adherence molecule. Most probably involved, with PEB1C, in a binding-protein-dependent transport system for an amino acid. May be involved in binding to intestinal cells.
Subcellular Location	Cell surface
Protein Families	Bacterial solute-binding protein 3 family
Tag Information	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time