Item no. |
CSB-EP365805ENV-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Short name:,PBP-1a,Short name:,PBP1a,Including the following 2 domains:,Penicillin-insensitive transglycosylase ,Alternative name(s):,Peptidoglycan TGase,Penicillin-sensitive transpeptidase,Alternative name(s):,DD-transpeptidase |
Available |
|
Research Topic |
Microbiology |
Uniprot ID |
P02918 |
Gene Names |
mrcA |
Organism |
Escherichia coli (strain K12) |
AA Sequence |
MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPY LSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQA AQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDN NKITDTLKALPTYGPLLPAAVTSANPQQATAMLAD GSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQ TGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGA VMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYT AAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSP PQYAGPIRLRQGLGQSKNVVM |
Expression Region |
229-529aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
49.5 kDa |
Alternative Name(s) |
Short name: PBP-1a Short name: PBP1a Including the following 2 domains: Penicillin-insensitive transglycosylase Alternative name(s): Peptidoglycan TGase Penicillin-sensitive transpeptidase Alternative name(s): DD-transpeptidase |
Relevance |
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
Reference |
"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110."Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006) . |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Cell wall formation. Synthesis of cross-linked peptidoglycan from the lipid intermediates. The enzyme has a penicillin-insensitive transglycosylase N-terminal domain (formation of linear glycan strands) and a penicillin-sensitive transpeptidase C-terminal domain (cross-linking of the peptide subunits). |
Subcellular Location |
Cell inner membrane, Single-pass type II membrane protein |
Protein Families |
Glycosyltransferase 51 family; Transpeptidase family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.