« Back
Home /
Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Recombinant Escherichia coli Type 1 fimbrin D-mannose specific adhesin(fimH)

Item no.	CSB-EP362349ENVa0-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Microbiology
Uniprot ID	P08191
Gene Names	fimH
Organism	Escherichia coli (strain K12)
AA Sequence	FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLV VDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSN FSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPV ALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSD DFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDY PGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFT NTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGT SAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Expression Region	22-300aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	33, 1
Relevance	Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Reference	"Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110."Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T.Mol. Syst. Biol. 2:E1-E5(2006).
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed.
Subcellular Location	Fimbrium
Protein Families	Fimbrial protein family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time