« Back
Home /
Recombinant Escherichia coli Deoxyribodipyrimidine photo-lyase(phrB)

Recombinant Escherichia coli Deoxyribodipyrimidine photo-lyase(phrB)

Item no.	CSB-EP360595ENV-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	P00914
Gene Names	phrB
Organism	Escherichia coli (strain K12)
AA Sequence	MTTHLVWFRQDLRLHDNLALAAACRNSSARVLALY IATPRQWATHNMSPRQAELINAQLNGLQIALAEKG IPLLFREVDDFVASVEIVKQVCAENSVTHLFYNYQ YEVNERARDVEVERALRNVVCEGFDDSVILPPGAV MTGNHEMYKVFTPFKNAWLKRLREGMPECVAAPKV RSSGSIEPSPSITLNYPRQSFDTAHFPVEEKAAIA QLRQFCQNGAGEYEQQRDFPAVEGTSRLSASLATG GLSPRQCLHRLLAEQPQALDGGAGSVWLNELIWRE FYRHLITYHPSLCKHRPFIAWTDRVQWQSNPAHLQ AWQEGKTGYPIVDAAMRQLNSTGWMHNRLRMITAS FLVKDLLIDWREGERYFMSQLIDGDLAANNGGWQW AASTGTDAAPYFRIFNPTTQGEKFDHEGEFIRQWL PELRDVPGKVVHEPWKWAQKAGVTLDYPQPIVEHK EARVQTLAAYEAARKGK
Expression Region	1-472aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW	73.7 kDa
Alternative Name(s)	DNA photolyase Photoreactivating enzyme
Relevance	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.
Reference	"Active site of Escherichia coli DNA photolyase: mutations at Trp277 alter the selectivity of the enzyme without affecting the quantum yield of photorepair." Li Y.F., Sancar A. Biochemistry 29:5698-5706(1990)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.
Protein Families	DNA photolyase class-1 family
Tag Information	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time