« Back
Home /
Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvA(ruvA)

Recombinant Escherichia coli Holliday junction ATP-dependent DNA helicase RuvA(ruvA)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP359062ENV-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Purity	Greater than 90% as determined by SDS-PAGE.
Research areas	Others
Target / Protein	ruvA
Biologically active	Not Test
Expression system	E.coli
Species of origin	Escherichia coli (strain K12)
Uniprot ID	P0A809
AA Sequence	MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCF YELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERT LFKELIKTNGVGPKLALAILSGMSAQQFVNAVERE EVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLF TPAADLVLTSPASPATDDAEQEAVAALVALGYKPQ EASRMVSKIARPDASSETLIREALRAAL
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-203aa
Protein length	Full Length
MW	38.1 kDa
Relevance	The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing. RuvA stimulates, in the presence of DNA, the weak ATPase activity of RuvB. Binds both single- and double-stranded DNA (dsDNA). Binds preferentially to supercoiled rather than to relaxed dsDNA.
References	A dual function of the CRISPR-Cas system in bacterial antivirus immunity and DNA repair.Babu M., Beloglazova N., Flick R., Graham C., Skarina T., Nocek B., Gagarinova A., Pogoutse O., Brown G., Binkowski A., Phanse S., Joachimiak A., Koonin E.V., Savchenko A., Emili A., Greenblatt J., Edwards A.M., Yakunin A.F.Mol. Microbiol. 79:484-502(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is a helicase that mediates the Holliday junction migration by localized denaturation and reannealing. RuvA stimulates, in the presence of DNA, the weak ATPase activity of RuvB. Binds both single- and double-stranded DNA (dsDNA). Binds preferentially to supercoiled rather than to relaxed dsDNA.
Subcellular Location	Cytoplasm
Protein Families	RuvA family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP359062ENV-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time