« Back
Home /
Recombinant Staphylococcus aureus Enterotoxin type C-3(entC3)

Recombinant Staphylococcus aureus Enterotoxin type C-3(entC3)

Item no.	CSB-EP357923FKZ-200
Manufacturer	Cusabio
Amount	200ug
Quantity options	1mg 10ug 100ug 20ug 200ug 50ug 500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SEC3
Available
Research Topic	Others
Uniprot ID	P0A0L5
Gene Names	entC3
Organism	Staphylococcus aureus
AA Sequence	ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSA TKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLN EDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVT GGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKR NTISFEVQTDKKSVTAQELDIKARNFLINKKNLYE FNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQ SKYLMMYNDNKTVDSKSVKIEVHLTTKNG
Expression Region	28-266aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	43.6 kDa
Alternative Name(s)	SEC3
Relevance	Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Reference	Crystal structure of a T-cell receptor beta-chain complexed with a superantigen.Fields B.A., Malchiodi E.L., Li H., Ysern X., Stauffacher C.V., Schlievert P.M., Karjalainen K., Mariuzza R.A.Nature 384:188-192(1996)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death.
Subcellular Location	Secreted
Protein Families	Staphylococcal/streptococcal toxin family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP357923FKZ-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time