« Back
Home /
Recombinant Staphylococcus aureus Gamma-hemolysin component B(hlgB)

Recombinant Staphylococcus aureus Gamma-hemolysin component B(hlgB)

Item no.	CSB-EP357862SKY-500
Manufacturer	Cusabio
Amount	500ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	H-gamma-1,H-gamma-I
Available
Research areas	others
Target / Protein	hlgB
Biologically active	Not Test
Expression system	E.coli
Species of origin	Staphylococcus aureus (strain N315)
Uniprot ID	P0A075
AA Sequence	AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPN DYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQ NEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFS ETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNN GWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIA QHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVT YQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYE IDWENHKVKLLDTKETENNK
Tag Info	N-terminal 6xHis-tagged
Expression Region	26-325aa
Protein length	Full Length of Mature Protein
MW	38.1 kDa
Alternative Name(s)	H-gamma-1 H-gamma-I
Relevance	Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity
References	"Shotgun proteomic analysis of total and membrane protein extracts of S. aureus strain N315." Vaezzadeh A.R., Deshusses J., Lescuyer P., Hochstrasser D.F. Submitted (OCT-2007)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity (By similarity).
Protein Families	Aerolysin family
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP357862SKY-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time