« Back
Home /
Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

Recombinant Mouse Carboxylesterase 1C(Ces1c),partial

Item no.	CSB-EP338557MOe1-1
Manufacturer	Cusabio
Amount	1mg
Category	Oncology Metabolism Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins By Organ Lung Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research Areas	others
Target / Protein	Ces1c
Biologically Active	Not Test
Expression System	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P23953
AA Sequence	HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGV PFAKPPLGSLRFAPPQPAEPWSFVKNATSYPPMCS QDAGWAKILSDMFSTEKEILPLKISEDCLYLNIYS PADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALS AHENVVVVTIQYRLGIWGLFSTGDEHSPGNWAHLD QLAALRWVQDNIANFGGNPDSVTIFGESSGGISVS VLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAV NEIIATLSQCNDTSSAAMVQCLRQKTESELLEISG KLVQYNISLSTMIDGVVLPKAPEEILAEKSFNTVP YIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLL LRRFHSELNISESMIPAVIEQYLRGVDDPAKKSEL ILDMFGDIFFGIPAVLLSRSLRDAGVSTYMYEFRY RPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGAS EEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYD EQEGYLQIGATTQQAQRLKAEEVAFWTELLAKNPP ETDPTEH
Tag Info	Tag-Free
Expression Region	19-550aa
Protein Length	Partial
MW	58.6 kDa
Alternative Name(s)	Liver carboxylesterase N Lung surfactant convertase PES-N
Relevance	Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Reference	Proteome-wide characterization of N-glycosylation events by diagonal chromatography. Ghesquiere B., Van Damme J., Martens L., Vandekerckhove J., Gevaert K. J. Proteome Res. 5:2438-2447(2006)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
Subcellular Location	Endoplasmic reticulum lumen
Protein Families	Type-B carboxylesterase/lipase family
Tissue Specificity	Expressed in lung, kidney and liver.
Tag Information	Tag-Free

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Request delivery time