Item no. |
CSB-EP337329MO-500 |
Manufacturer |
Cusabio
|
Amount |
500ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Islet of Langerhans regenerating protein 1,Short name:REG 1,Pancreatic stone protein 1,Short name:PSP,Pancreatic thread protein 1,Short name:PTP,Regenerating protein 1 |
Available |
|
Research areas |
Cell Biology |
Target / Protein |
Reg1 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Mus musculus (Mouse) |
Uniprot ID |
P43137 |
AA Sequence |
QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTW ADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESG TTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATG SPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVC KFKG |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
22-165aa |
Protein length |
Full Length of Mature Protein |
MW |
32.2 kDa |
Alternative Name(s) |
Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1 |
Relevance |
Might act as an inhibitor of spontaneous calcium carbonate precipitation. |
References |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Might act as an inhibitor of spontaneous calcium carbonate precipitation. |
Subcellular Location |
Secreted |
Tissue Specificity |
Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.