« Back
Home /
Recombinant Mouse Lithostathine-1(Reg1)

Recombinant Mouse Lithostathine-1(Reg1)

Item no.	CSB-EP337329MO-200
Manufacturer	Cusabio
Amount	200ug
Category	Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 5.1	34160400
ECLASS 6.1	34160400
ECLASS 8.0	42020190
ECLASS 9.0	42020190
ECLASS 10.0.1	32160409
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Islet of Langerhans regenerating protein 1,Short name:REG 1,Pancreatic stone protein 1,Short name:PSP,Pancreatic thread protein 1,Short name:PTP,Regenerating protein 1
Available
Research areas	Cell Biology
Target / Protein	Reg1
Biologically active	Not Test
Expression system	E.coli
Species of origin	Mus musculus (Mouse)
Uniprot ID	P43137
AA Sequence	QEAEEDLPSARISCPEGSNAYSSYCYYFTEDRLTW ADADLFCQNMNSGYLVSVLSQAEGNFVASLIKESG TTDANVWTGLHDPKRNRRWHWSSGSLFLYKSWATG SPNSSNRGYCVSLTSNTGYKKWKDDNCDAQYSFVC KFKG
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	22-165aa
Protein length	Full Length of Mature Protein
MW	32.2 kDa
Alternative Name(s)	Islet of Langerhans regenerating protein 1 Short name:REG 1 Pancreatic stone protein 1 Short name:PSP Pancreatic thread protein 1 Short name:PTP Regenerating protein 1
Relevance	Might act as an inhibitor of spontaneous calcium carbonate precipitation.
References	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Might act as an inhibitor of spontaneous calcium carbonate precipitation.
Subcellular Location	Secreted
Tissue Specificity	Expressed only in regenerating islets and normal exocrine pancreas, but not in normal pancreatic islets. Expressed strongly in pancreas, moderately in gall bladder, and weakly in liver.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time