Item no. |
CSB-EP335866VAR-50 |
Manufacturer |
Cusabio
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
AA Sequence |
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAI VKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEK CCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTG RRPYE |
Research Topic |
Others |
Uniprot ID |
P33816 |
Gene Names |
A27L |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
1-110aa |
MW of Fusion Proten |
16, 5 |
Sequence Info |
Full Length |
Relevance |
Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion |
Reference |
"Creation of a clone library of fragments from the natural variola virus and study of the structural and functional organization of viral genes from a circle of hosts."Shchelkunov S.N., Marennikova S.S., Totmenin A.V., Blinov V.M., Chizhikov V.E., Gutorov V.V., Safronov P.F., Pozdnyakov S.G., Shelukhina E.M., Gashnikov P.V., Anjaparidze O.G., Sandakhchiev L.S.Dokl. Akad. Nauk SSSR 321:402-406(1991) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus) |
Tag Information |
N-terminal 6xHis-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.