« Back
Home /
Recombinant Variola virus 14 kDa fusion protein(A27L)

Recombinant Variola virus 14 kDa fusion protein(A27L)

Item no.	CSB-EP335866VAR-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Purity	Greater than 90% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
AA Sequence	MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAI VKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEK CCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTG RRPYE
Research Topic	Others
Uniprot ID	P33816
Gene Names	A27L
Tag Info	N-terminal 6xHis-tagged
Expression Region	1-110aa
MW of Fusion Proten	16, 5
Sequence Info	Full Length
Relevance	Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion
Reference	"Creation of a clone library of fragments from the natural variola virus and study of the structural and functional organization of viral genes from a circle of hosts."Shchelkunov S.N., Marennikova S.S., Totmenin A.V., Blinov V.M., Chizhikov V.E., Gutorov V.V., Safronov P.F., Pozdnyakov S.G., Shelukhina E.M., Gashnikov P.V., Anjaparidze O.G., Sandakhchiev L.S.Dokl. Akad. Nauk SSSR 321:402-406(1991)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time