Item no. |
CSB-EP333755BRJ-10 |
Manufacturer |
Cusabio
|
Amount |
10ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 5.1 |
34160400 |
ECLASS 6.1 |
34160400 |
ECLASS 8.0 |
42020190 |
ECLASS 9.0 |
42020190 |
ECLASS 10.0.1 |
32160409 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
PBP 4*,Alternative name(s):,PBP 4A,Penicillin-binding protein E |
Available |
|
Research areas |
Microbiology |
Target / Protein |
pbpE |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Bacillus subtilis (strain 168) |
Uniprot ID |
P32959 |
AA Sequence |
MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDIL YHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALG IILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLN HTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEG LSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYAD FIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYV YDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSV TSDLFRFDQALYQDDFISKASKESAFSPVRLNNGE TIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIR YIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQ PYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTA AQVTTENERLYLEIAGQLRLELFPSSETRFFLRAL SVEVEFTLGEDAAKSFILYEDGSEEEAVRTK |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-451aa |
Protein length |
Full Length |
MW |
67.4 kDa |
Alternative Name(s) |
PBP 4* Alternative name(s): PBP 4A Penicillin-binding protein E |
Relevance |
Probably involved in peptidoglycan modification during cortex synthesis. |
References |
"The complete genome sequence of the Gram-positive bacterium Bacillus subtilis."Kunst F., Ogasawara N., Moszer I., Albertini A.M., Alloni G., Azevedo V., Bertero M.G., Bessieres P., Bolotin A., Borchert S., Borriss R., Boursier L., Brans A., Braun M., Brignell S.C., Bron S., Brouillet S., Bruschi C.V. Danchin A.Nature 390:249-256(1997). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Probably involved in peptidoglycan modification during cortex synthesis. |
Subcellular Location |
Cell membrane, Peripheral membrane protein |
Protein Families |
Beta-lactamase family |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.