« Back
Home /
Recombinant Human HLA class I histocompatibility antigen, A alpha chain(HLA-A),partial

Recombinant Human HLA class I histocompatibility antigen, A alpha chain(HLA-A),partial

Item no.	CSB-EP328989HU-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Others
Target / Protein	HLA-A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P30443
AA Sequence	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVR FDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAH SQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAA QITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENG KETLQRTDPPKTHMTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWA AVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQP TIPI
Tag Info	N-terminal 6xHis-tagged
Expression Region	25-308aa
Protein length	Extracellular Domain
MW	36.7 kDa
Alternative Name(s)	MHC class I antigen A*1 HLAA
Relevance	Involved in the presentation of foreign antigens to the immune system.
References	"A generic sequencing based typing approach for the identification of HLA-A diversity." Sitha S., Scheltinga S.A., Johnston-Dow L.A., White C.B., der van Zwan A.W., Bakema J.E., Rozemuller E.H., van der Tweel J.G., Kronink M.N., Tilanus M.G.J. Hum. Immunol. 57:120-128(1997)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the presentation of foreign antigens to the immune system.
Subcellular Location	Membrane, Single-pass type I membrane protein
Protein Families	MHC class I family
Paythway	Cellularsenescence
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time