Item no. |
CSB-EP326426DRZ-100 |
Manufacturer |
Cusabio
|
Amount |
100ug |
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid or Lyophilized powder |
Specific against |
other |
Host |
E.coli |
Purity |
Greater than 90% as determined by SDS-PAGE. |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Large-CRP,Alternative name(s):,60KDA cysteine-rich OMP,Short name:,60KDA CRP,60KDA outer membrane protein,Cysteine-rich outer membrane protein |
Available |
|
Research Areas |
Microbiology |
Uniprot ID |
P23700 |
Gene Names |
omcB |
Organism |
Chlamydia pneumoniae (Chlamydophila pneumoniae) |
AA Sequence |
SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFC DKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDC NVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVI TQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAG DKCKITVWVKPLKEGC |
Expression Region |
41-196aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
33.3 kDa |
Alternative Name(s) |
Large-CRP Alternative name(s): 60KDA cysteine-rich OMP Short name: 60KDA CRP 60KDA outer membrane protein Cysteine-rich outer membrane protein |
Relevance |
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity). |
Reference |
Comparison of whole genome sequences of Chlamydia pneumoniae J138 from Japan and CWL029 from USA.Shirai M., Hirakawa H., Kimoto M., Tabuchi M., Kishi F., Ouchi K., Shiba T., Ishii K., Hattori M., Kuhara S., Nakazawa T.Nucleic Acids Res. 28:2311-2314(2000). |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Form |
Liquid or Lyophilized powder |
Buffer |
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity). |
Subcellular Location |
Periplasm |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.