« Back
Home /
Recombinant Ornithodoros moubata Tick anticoagulant peptide

Recombinant Ornithodoros moubata Tick anticoagulant peptide

Item no.	CSB-EP325525OCK-50
Manufacturer	Cusabio
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc
Purity	Greater than 85% as determined by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Research areas	Others
Target / Protein	N/A
Biologically active	Not Test
Expression system	E.coli
Species of origin	Ornithodoros moubata (Soft tick) (Argasid tick)
Uniprot ID	P17726
AA Sequence	YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDS FWICPEDHTGADYYSSYRDCFNACI
Tag Info	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region	1-60aa
Protein length	Full Length
MW	27.0 kDa
Relevance	TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
References	"NMR solution structure of the recombinant tick anticoagulant protein (rTAP), a factor Xa inhibitor from the tick Ornithodoros moubata." Antuch W., Guntert P., Billeter M., Hawthorne T., Grossenbacher H., Wuethrich K. FEBS Lett. 352:251-257(1994)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
Tag Information	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time